NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079992_135315

Scaffold Ga0079992_135315


Overview

Basic Information
Taxon OID3300005855 Open in IMG/M
Scaffold IDGa0079992_135315 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls B (FF_Mn_B) MetaG (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28737
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (62.16%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051584Metagenome / Metatranscriptome144Y
F093036Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0079992_13531529F093036GAGGMKRRRRTPLHERITKILNALPDGNWWTEGGQSGEIVPTLDLYLHIAAELGCSIDAYIDRVEGGRLYARAVLNCDGRVIVSESLAPIPENAEPETISEIASIAQSRAIIRACRLAWGAHIKAYLNPANARNQLLAIAHSLLRGVDREVRLQIASNILGAPVRSFADLTTAELAELISALVAEPSSQYTEEDQHGRTQQ*
Ga0079992_1353153F051584N/AMTRTEQVLQRVLDELRVGIEGAIRSHPTVYDDCPLPEGYYFGLPDLRRVSAMPILAVELDSETLATRTLGGVGVGRRERVLPVLVVIAHAHREEERLMRQLIQLCDAIVQVLELAAQSEFWLIQEVGLVDFSPPIEGEQSMPFVRYASVRVVVQVRHTRGEV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.