Scaffold Ga0080005_127380

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0080005_127380

Scaffold Ga0080005_127380

Overview

Basic Information
Taxon OID	3300005856 Open in IMG/M
Scaffold ID	Ga0080005_127380 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPADES assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10808
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Joseph's Coat, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.376	Long. (^o)	-110.69	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080679	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080005_1273809	F080679	AGTAGG	MDEDAISRLLSKKSLRIIRYLYNNDYATLRTLEKALRMNGVTAREYIDLLSKYGIVKVSRVGRAYVIMLNREGKTTKAILTFLREVGYL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.