NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080005_132630

Scaffold Ga0080005_132630


Overview

Basic Information
Taxon OID3300005856 Open in IMG/M
Scaffold IDGa0080005_132630 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5762
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameJoseph's Coat, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062912Metagenome / Metatranscriptome130Y
F077497Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0080005_1326302F077497N/AMDKEAINKIEEILEKHLFMETNNPDYELKKIDVIIKYLIYQKLKDIDETLKSIDENLFISANKGIYEE*
Ga0080005_1326304F062912N/ALGLVNFIKLKLHIYSMDPLEVLEKAYNLFLASEIIESESSIDKELEQLLLNRDYEKMAKTLLYILVYTLNRDPAYKNIRNIYISEAIDLLYVIDRIGFNDERIIKRFVHLLYRFYSYSLEYKIKFITDNGKRELIKAKLNELVNII*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.