Scaffold Ga0079995_1061053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079995_1061053

Scaffold Ga0079995_1061053

Overview

Basic Information
Taxon OID	3300005858 Open in IMG/M
Scaffold ID	Ga0079995_1061053 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C) (SPADES assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3564
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.376	Long. (^o)	-110.69	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051584	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079995_10610536	F051584	GGAGG	MTRTEQVLQRVLDELRVGIEDAIRNDPRVYDDCPLPEDYYFGLPDLRRVSAMPIVAVELDSETLATRTLGGVGVGRRERVLPVLVVIAHAHREEERLMRQLIQLCDAVVQVLERVSQSEFWFIQEVGLVDFSPPIEGEQSMPFVRYASVRVVVQVRHTRGEVG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.