NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079995_1061053

Scaffold Ga0079995_1061053


Overview

Basic Information
Taxon OID3300005858 Open in IMG/M
Scaffold IDGa0079995_1061053 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C) (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3564
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051584Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0079995_10610536F051584GGAGGMTRTEQVLQRVLDELRVGIEDAIRNDPRVYDDCPLPEDYYFGLPDLRRVSAMPIVAVELDSETLATRTLGGVGVGRRERVLPVLVVIAHAHREEERLMRQLIQLCDAVVQVLERVSQSEFWFIQEVGLVDFSPPIEGEQSMPFVRYASVRVVVQVRHTRGEVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.