Scaffold Ga0080004_1084385

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0080004_1084385

Scaffold Ga0080004_1084385

Overview

Basic Information
Taxon OID	3300005860 Open in IMG/M
Scaffold ID	Ga0080004_1084385 Open in IMG/M
Source Dataset Name	Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPADES assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1370
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Washburn Spring, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.376	Long. (^o)	-110.69	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000750	Metagenome / Metatranscriptome	908	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080004_10843851	F000750	N/A	VIITAFLFSYWFFKKKFRAKPLQLPINVETGDVIHGAFGSLLANLSLHQMYIDVMVGVLLYLAYQFTEFAVKQDTIYKDIATFTAGYFGTIVAGGIPL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.