NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080006_1151685

Scaffold Ga0080006_1151685


Overview

Basic Information
Taxon OID3300005861 Open in IMG/M
Scaffold IDGa0080006_1151685 Open in IMG/M
Source Dataset NameFerric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3487
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026046Metagenome / Metatranscriptome199Y
F071410Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0080006_11516853F026046N/AMAGLLEIYEGYLNKPSCDALDNIRIGKDGIGYRKLRKEDIPIEWLNYAKKHGIKVRDRTLIIGDALDPVDPNCMPLMNAFYPQTSSGKWCCTPAIAQYVNSGSQTPTQICFSAGGYNGINIPYMGIALIDANGNLDLLMDTNNVISNATPNWQNPSSNPPAMVCGAQQYNGSVYMSFVANPKTTFNISSAYLLIGTNTLASGGVFSTIMEWTGINYQTTQNTPLTINIYLYVS*
Ga0080006_11516854F071410AGTAGMNKDKDLSTYRFNKDSTLQLIAVGISKQVSNARGSVVSITTSNILSELNGDKPIIGFVAWRSIIKYFLDALVSRGYMIMYRKGNKKPYNTARVHVYMIPKRLKHNIPNPLFSTDPNLIYVFLKSVLSNVD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.