Basic Information | |
---|---|
Taxon OID | 3300005900 Open in IMG/M |
Scaffold ID | Ga0075272_1103245 Open in IMG/M |
Source Dataset Name | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 549 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Twitchell Island, California | |||||||
Coordinates | Lat. (o) | 38.1087 | Long. (o) | -121.653 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092949 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075272_11032452 | F092949 | N/A | MAASSGSSSAGSSRADELWRRVGDAVGPAGELTPLLEKVRDQAWRITDRDVAGLDADALYEAVLPVAFAAADAKRRRAHEAIDAH* |
⦗Top⦘ |