NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075108_10001265

Scaffold Ga0075108_10001265


Overview

Basic Information
Taxon OID3300005913 Open in IMG/M
Scaffold IDGa0075108_10001265 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12755
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAce Lake, Antarctica
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036782Metagenome / Metatranscriptome169Y
F046473Metagenome / Metatranscriptome151Y
F051477Metagenome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0075108_1000126514F051477AGGAGMFTWIKKIINKIKQELAYRKRLKELKKKDPFIYK*
Ga0075108_100012653F036782N/AMDIGSLKNLSDLSYDTAVAKRNALEKATSRLVVVYNEHIFRADPQTICLVRTLKESQDSFYLLDTNNNPVEITTPDEFLSILLERNQESLNAYNQIYKTFARKDA*
Ga0075108_100012656F046473AGGAGMPGLFEALKNMPKREPKKFFITVQGKEHEVSLEKKLWSQQHGEENLVFKDGEIVVKPAQLPKSKYRTLVKSQKGYFFEDDDIHWPNKIAEGGVTWQTKSE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.