Scaffold Ga0081455_10005617

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081455_10005617

Scaffold Ga0081455_10005617

Overview

Basic Information
Taxon OID	3300005937 Open in IMG/M
Scaffold ID	Ga0081455_10005617 Open in IMG/M
Source Dataset Name	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13701
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (93.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location Name	University of Puerto Rico, San Juan, Puerto Rico
Coordinates	Lat. (^o)	18.402889	Long. (^o)	-66.050054	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073315	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081455_100056176	F073315	GGA	MAGNEFILKTCPRVIRKLLRWMREKKLGEFTNADIKDMCENQLWEDTVRELGL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.