Scaffold Ga0073926_10002240

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073926_10002240

Scaffold Ga0073926_10002240

Overview

Basic Information
Taxon OID	3300005943 Open in IMG/M
Scaffold ID	Ga0073926_10002240 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3586
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Columbia River, Washington
Coordinates	Lat. (^o)	46.372	Long. (^o)	-119.272	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077255	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073926_100022405	F077255	GGAGG	VIHLFNGRLILERRSLAENWRCRVRIGPNPEQQIEVDLYTPDLRTAFIRSNNIYQAFRAGKKLEPLEDPERTGLRCWDCIQWAPLLAHNGGNACSLGFPEAKSYPNGRFANLCSLYSDGTDRAEPD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.