NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073926_10005468

Scaffold Ga0073926_10005468


Overview

Basic Information
Taxon OID3300005943 Open in IMG/M
Scaffold IDGa0073926_10005468 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2241
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001120Metagenome / Metatranscriptome772Y
F001165Metagenome / Metatranscriptome760Y
F029405Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0073926_100054681F001120N/AMTKKSPINFDRTIAGVNITENGIKSYTKSFQLGPFQLTLNARESGVHGSISLPGTGISKRNIKI
Ga0073926_100054683F001165N/AMSTMSPLNDAPKPRIPDAIDKQRLQAMQLVAKMKESADKYGVGFVGGFVSPDGQKFMMTNMDEADTNALLPNDLK*
Ga0073926_100054686F029405N/AMQSTLDFIDEQRNADMLDALADIAYEQEQAMRESEQSDWDGIDEISDAERNACDHYNERYVITTHG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.