NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081473_138232

Scaffold Ga0081473_138232


Overview

Basic Information
Taxon OID3300005958 Open in IMG/M
Scaffold IDGa0081473_138232 Open in IMG/M
Source Dataset NameHypoxic/sulfidic aquatic microbial communities from Cistern Spring, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)37393
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)48 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park, Wyoming
CoordinatesLat. (o)44.7230812Long. (o)-110.7040247Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013613Metagenome / Metatranscriptome269Y
F076880Metagenome117N
F077496Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0081473_13823216F076880GAGGMAPEKAVRAFVLRIVKGYRAFLRTEDLFPNDPWAHASDLADRLYYAAYSYTDSSEEAELLRRLAQVSYNDFNELKAVWDTFGESQRKRAFRQLLYAVAKIGYEELLKTIANSWELKTNADKRRQVIDAFKRYITDDHINRRMRLTVALADVFWPDDKARKESVGRIVALWNGLLLDSFIPRDKVEKLIEKHILSIEAPKAVEGTAETR*
Ga0081473_1382322F013613AGGAGGMPRPRKYPDRGVTLTAYVSRELYERIVGLARSRGLSVSEVVQELLMKGLEGSVAVAADPPDPPEDALHVALKGLEPLERERVLQFMKGLEDAEAKLAKLGPNVRQTRTGRPTLLDVVNQQEVAKLKGTVVDLKRTYERSIKRIVRDPAALNIIGERLLRLMKELGVPP*
Ga0081473_1382323F077496GGTGGLSAPQEEVGARLGRRKKWSGDAVIMTIYIPLDIKKELEARAAARRKSLSEYAVSLILKGLEAEKAEEANKDAKAEEVP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.