NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081474_139947

Scaffold Ga0081474_139947


Overview

Basic Information
Taxon OID3300005977 Open in IMG/M
Scaffold IDGa0081474_139947 Open in IMG/M
Source Dataset NameFerrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)5384
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → Candidatus Nanoarchaeia → Nanoarchaeales → Nanopusillaceae → Candidatus Nanobsidianus → Candidatus Nanobsidianus stetteri(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOne Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7330426Long. (o)-110.7089928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097670Metagenome / Metatranscriptome104Y
F099549Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0081474_1399474F099549N/AMDTNLQYSYQIPDLKTRFQIDFGNIIEQIVELLTYSDISTDTGTFDNEELKNKLRAAISYALGLLASAWGYSMSERVQQDVLIAKESLIALFDAIMTNPELTYIDLLNIYFTLIQQVSIILNYGTPIPQPRTGNYEIT*
Ga0081474_1399478F097670N/AMNYKIFDKNIFFETDHIIIIDLKNNEIKHEEKYYFYDGKELKEIKDLQEYNLKLYEISQKIQEEFTKFSTKYAKPPIGYMPISNIIYEFMLNRNNIVLISYANISKVENEVSKEITNDTIKIIVKSKTIFNKEWNFESTQNLSPEIKDNTTKIIEKALKSAKMILKNNL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.