Scaffold Ga0081538_10151929

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081538_10151929

Scaffold Ga0081538_10151929

Overview

Basic Information
Taxon OID	3300005981 Open in IMG/M
Scaffold ID	Ga0081538_10151929 Open in IMG/M
Source Dataset Name	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1047
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location Name	University of Puerto Rico, San Juan, Puerto Rico
Coordinates	Lat. (^o)	18.402889	Long. (^o)	-66.050054	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102768	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081538_101519291	F102768	AGG	VRMQTFLVRVWIPAADEENDERRPLRGVVEHVASRRGATFHGELDLLDFIRGCLQAPPEVLPPVVDKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.