NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066790_10080853

Scaffold Ga0066790_10080853


Overview

Basic Information
Taxon OID3300005995 Open in IMG/M
Scaffold IDGa0066790_10080853 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1398
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)68.6135Long. (o)-149.3144Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F002408Metagenome / Metatranscriptome562Y
F005213Metagenome / Metatranscriptome408N
F036729Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0066790_100808531F036729GAGGMIQHSENSRREMTNAEAGVVGAVLGFGLIALLLYLAVERYHIRKEQLAEAGLYLFVI
Ga0066790_100808532F005213AGGAGMASSATKMANEPEQTGEERQPDVQLQDVLFSALVTSVCYWTTIFLLAIVGTYLIDWWLTHPGPYAAPANDPWGITTPPWLILPLAPIGVVGSHGHAVWCALRGQRTWKMLITAASLVAVMGCSKLLEIYLAPM*
Ga0066790_100808533F001473GAGMESEYQTVGQMYERLRLMIRQRNDTGFRLAMTDAVLEPRNPFEPASKRRPKSVVAITLILALVLALIFLYFSFHHAR*
Ga0066790_100808534F002408N/AAVVSTVPNEMLLNSTPVRLVGGAAAAKADLGVLIRDVYRRQDEVFVRFSIENRSSQTLRAGPPAVVSLTGLKFDRSLWAFQNTQLGTEYASRLKTYDAPIPVKIRQCEPGVAEVGPGEARIGLIALQLPPVNPDAKKTQPTVLKILFPIDRAGNLTATLVL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.