NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070717_10008748

Scaffold Ga0070717_10008748


Overview

Basic Information
Taxon OID3300006028 Open in IMG/M
Scaffold IDGa0070717_10008748 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7576
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004042Metagenome / Metatranscriptome456Y
F023475Metagenome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0070717_1000874811F004042AGGAGGMNGKHLGLLLLAGCLFVPQLQAQIKHIEMRVEGMT*
Ga0070717_1000874812F000092GAGVKQHLQRQSGVANVDVSLIDGKVEVTPKEDGKVDPTQLLKATYDSGVSVAELDMTATGKLVKDSSGNLVLQVNASQSFVLAQNGLSKGLEPLADSATVLTVRGQLFKKGAGKQKKSEFSAALKLVLLEV
Ga0070717_100087486F023475GGAGMKLFSVLFVFLSFPTALVSQEFSCPAGQADVMKYFAMSSDKRADHFLKGQPNPIFTKVVPDRDFAATGYWFWLKSPQAHGFDVKSFDEKNVYMRATELEWKDNATFKRFERDLPIAARCVAEGKSGPEIKVDDTRFRYFASCRPYKSSNVGRAVNDLDAPVLMDAGGNLGEVWTRVLHYHYNCDGQFQHCKDEEQFYLGNGYGLWQWKHFRNGELLKTALMHDFETGKAQATLSCEESYH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.