NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075470_10033927

Scaffold Ga0075470_10033927


Overview

Basic Information
Taxon OID3300006030 Open in IMG/M
Scaffold IDGa0075470_10033927 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1578
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F074876Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0075470_100339272F000671GAGGMDKILCYSCNKSKHKLNAKKSSLLPINLLMCESCINSKFEPRWLIILAGRSNGADHVREFVLKKRYIGNEISASELLV*
Ga0075470_100339273F074876AGAAGGVQEFYEIINVVYIYEEKTYGTVDQLGAFASLVKYKKDGIDYEELLENDEFAIVDEIVFHHVEENNG*
Ga0075470_100339274F000473AGGAGVSSSHFYDDKHFKYGINQWTGEPNKPVFYNEEMKKKIRELKKPGMLIMDIAMYPDFLAIRLYEDNFLQFDGIKKEQVVAYVDKVKKVIESFGVRCELEGVPSARVL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.