NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075365_10083365

Scaffold Ga0075365_10083365


Overview

Basic Information
Taxon OID3300006038 Open in IMG/M
Scaffold IDGa0075365_10083365 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2168
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8443Long. (o)-83.9607Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016999Metagenome / Metatranscriptome243Y
F029854Metagenome / Metatranscriptome187Y
F031728Metagenome / Metatranscriptome181N

Sequences

Protein IDFamilyRBSSequence
Ga0075365_100833653F016999GGAGMNPKDEDFICFYRDAVIAGHGDPAAETMRRFNLSHDYTVRLLNEAIARCDGLDIRNWNRRIGHQSAVD*
Ga0075365_100833655F029854GGAMKPSALRIERLLAKFEAALVCNARVRRYVFHPYEVAEAEAQGLPYVLVPRVCSSSREWMERYGAQPATIQMGQPK*
Ga0075365_100833656F031728GAGGMGMDPKGPLQGLLRPDRFFWARALAWSVVFGTALWIAYKFSEGVGVDLGLGVSSGVPTVLGVLAAFALYVLSVCLIEQRLPGELGLAQLAPELAAGFA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.