Basic Information | |
---|---|
Taxon OID | 3300006041 Open in IMG/M |
Scaffold ID | Ga0075023_100425912 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 580 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Pennsylvania | |||||||
Coordinates | Lat. (o) | 41.5935 | Long. (o) | -78.5142 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074659 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075023_1004259121 | F074659 | N/A | HYIAFSEPAIAKTRLVSLLSSKIAESGSAVTNFG* |
⦗Top⦘ |