Basic Information | |
---|---|
Taxon OID | 3300006052 Open in IMG/M |
Scaffold ID | Ga0075029_100166184 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1364 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Pennsylvania, Clearfield County | |||||||
Coordinates | Lat. (o) | 41.170727 | Long. (o) | -78.4726 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002605 | Metagenome / Metatranscriptome | 544 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075029_1001661841 | F002605 | AGG | MAARPAGIAGWTGEHLRHAATLVRQGRNPAARVYESIGADSFLAIAPGWLNLGLWEGHGSEDEAEAACGRLVRTLASALPTDGVVVDAGNGLATQDPLIAETARPRRLIAVNITE |
⦗Top⦘ |