 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006067 Open in IMG/M |
| Scaffold ID | Ga0081426_12373 Open in IMG/M |
| Source Dataset Name | Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Springs, Spring 3, Yellowstone National Park, Wyoming, USA - Mini-Metagenomics |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3529 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.761133 | Long. (o) | -110.7309 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040649 | Metagenome / Metatranscriptome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081426_123733 | F040649 | AGGAGG | MRKLNIDNPAKLFAQLSAITNACDPNEYAPLEYRIQGEEIELPDGSPATGDWLLAIKAVELADDLVQHAEGNGAMRRSFRLVYLAPLETYFWGGYYWRDPVGFTILVRWHRVPKDYNPQLDQIRQRNTDRRRSDA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |