Scaffold Ga0081428_105484

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081428_105484

Scaffold Ga0081428_105484

Overview

Basic Information
Taxon OID	3300006068 Open in IMG/M
Scaffold ID	Ga0081428_105484 Open in IMG/M
Source Dataset Name	Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	553
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.761133	Long. (^o)	-110.7309	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018544	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081428_1054842	F018544	N/A	MIGMTTQAQIGGTELKVRIEKALTEKSLKKLITNLEKELNGEHSFLPHDVEAQIRMEIASAGVAVSQHGGWYRCIAAYLLLPKLDELLAVKSTAGEQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.