NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007881_1097431

Scaffold Ga0007881_1097431


Overview

Basic Information
Taxon OID3300006072 Open in IMG/M
Scaffold IDGa0007881_1097431 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013499Metagenome / Metatranscriptome270N
F016116Metagenome / Metatranscriptome249N
F051691Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0007881_10974311F051691N/ARKNMCKVMPPLGHRVRTLHTQFTRLTDEEKDLIRPLLENALDKVLIMVRKINHNFQEEAERNTYQDSLIHE*
Ga0007881_10974312F013499AGGAMSEVMKDIGITISGIKGLIMLLQAHQRELVSKGEPDPSEGSLDAARLAIDQLKEKIEAIVGPEESTGAEGFEVEVHESEDQSQAE*
Ga0007881_10974313F016116AGGMVEKLAKHERLALYNLTEREIDQLEEELVKQFPKEQFAETYIEMWQIYRDTKAIQIYSLIEAKYPGSHNEEKRAVIWFEIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.