Scaffold Ga0081601_1123720

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081601_1123720

Scaffold Ga0081601_1123720

Overview

Basic Information
Taxon OID	3300006079 Open in IMG/M
Scaffold ID	Ga0081601_1123720 Open in IMG/M
Source Dataset Name	Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Plant Breeding Research
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	893
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea

Source Dataset Sampling Location
Location Name	Manus Basin, Bismarck Sea
Coordinates	Lat. (^o)	-3.7282978	Long. (^o)	151.672495	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029561	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081601_11237201	F029561	AGG	MSNQVDKLTDPEFAHTSILSRGQLQMIEDDPAKMETLARLMGAVNLDNLFRHMQNPTINPATRLEFQKMLNKMGKLEPDGKDVVGAGGPQVIINITRAKDREEAEAITIEGATV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.