 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006081 Open in IMG/M |
| Scaffold ID | Ga0081760_1154584 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS906_Marker113_DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 553 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.92274 | Long. (o) | -129.988104 | Alt. (m) | Depth (m) | 1522 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013312 | Metagenome | 272 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081760_11545841 | F013312 | N/A | TCNLFAVAAVTFTISLSLATKGADNNSDVPLAEIALTLNRLKTALSVSVIVTVIVSAFPESSDTSIDLITAVVAVGTVYKVVADVLVKSTFLFTNVLAIMP* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |