NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082018_1019657

Scaffold Ga0082018_1019657


Overview

Basic Information
Taxon OID3300006091 Open in IMG/M
Scaffold IDGa0082018_1019657 Open in IMG/M
Source Dataset NameMarine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMajor University, Chile
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)1218
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location
Location NameEastern Topical South Pacific
CoordinatesLat. (o)-13.71Long. (o)-81.389Alt. (m)Depth (m)405
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005148Metagenome / Metatranscriptome410Y
F008755Metagenome / Metatranscriptome328Y
F009404Metagenome / Metatranscriptome318Y

Sequences

Protein IDFamilyRBSSequence
Ga0082018_10196571F008755GGAGMNKSRVARDLWRKVFNDNLINLSDGDARKQVVRDFLNDPVNKKSGWKAKDARFFRLGFQKVAKENNFNVMNVGVTPTPSRSKTNKGSMNINVKSKQKNPAPMGEQLKKPEEVKGLGALPTTPQLEQQQAQAVQYSAQSVGQIFETIFNIFSSRTGCSPLSQNERIALGEAWSPIFNEYFSGHSNWVMPV
Ga0082018_10196572F009404AGGAGMSDEPEIIQPKGESLVKHCPICGVEFDEIVLTNRWLKCDSCETIFQVKVKTGE*
Ga0082018_10196573F005148GGAGMKQKKYEEFLKRTVPESEEVECKKCGLKFCDDFNLICLGALDMCLLCANRNLDKETIKEKYHE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.