Scaffold Ga0082021_1211103

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082021_1211103

Scaffold Ga0082021_1211103

Overview

Basic Information
Taxon OID	3300006092 Open in IMG/M
Scaffold ID	Ga0082021_1211103 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Nanyang Technological University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9532
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant → Activated Sludge Microbial Communities From Wastewater Treatment Plant In Ulu Pandan, Singapore

Source Dataset Sampling Location
Location Name	Ulu Pandan, Singapore
Coordinates	Lat. (^o)	1.3315	Long. (^o)	103.7543	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040163	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082021_121110314	F040163	GAG	MSTDPGLLAEVLRHALDGVAVVVPGDGSPRVAYANATLAALLRRPEEWLEQRPLEEFEIEAPVDPNLTGTAVGVRVRLKRADGTTVECERWAVMLPEARLCLYYRPAARSSPGALAAALDKTSGLSTPEHLIEVLRRDWSIAQRDGRRLTVMRFNID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.