Scaffold Ga0080710_1024354

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0080710_1024354

Scaffold Ga0080710_1024354

Overview

Basic Information
Taxon OID	3300006147 Open in IMG/M
Scaffold ID	Ga0080710_1024354 Open in IMG/M
Source Dataset Name	Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_691P_inflammed- viral_metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas Southwestern Medical Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1236
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Source Dataset Sampling Location
Location Name	UTSWMC, Dallas, Texas, USA
Coordinates	Lat. (^o)	32.73	Long. (^o)	-96.97	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039198	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080710_10243542	F039198	GGAG	MKITSTKISNVNYVQIYLTEEELKKQETKEVIEKYRKEKCNVAIFQIGKENYPEILKKIIEKQVELSTYVC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.