NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075441_10071522

Scaffold Ga0075441_10071522


Overview

Basic Information
Taxon OID3300006164 Open in IMG/M
Scaffold IDGa0075441_10071522 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1351
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011254Metagenome / Metatranscriptome293Y
F029901Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0075441_100715221F029901N/AMTRGILLFCFDTEHTKYHRVLERCVHLIKQNLKLQITVVTNFETFKRIRPLGFINYKFIEPEK
Ga0075441_100715223F011254N/ALPREDISDITIDNESIQHCLNAGVNTDNGYEIWLHGNPAVYFSRIARCIALDDLLRFKDLRSRYLVTESWNEKVEGDFIPTSVKQFFAMGDGPHWYHKDDFYNLPYVEYEGEVDTDFGLDEDLTFRDKKFYGAGNCQSLQPHPVLPTIKTEQIKNQKLRATMQQFGFTDILQMQYVELQPNSSLPVHRDDFTYQDGKSIIDGPTQLYCVLSGDVENIKFKFKDVGLVKVDKPIFINNHRFVHSLVYTGKQPRGVFLAYGVRKPK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.