NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066836_10196069

Scaffold Ga0066836_10196069


Overview

Basic Information
Taxon OID3300006166 Open in IMG/M
Scaffold IDGa0066836_10196069 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1198
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001066Metagenome / Metatranscriptome788Y
F065107Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0066836_101960692F001066N/AMDKKDNLFKIKPVDGKNIVVEDKRKTISPFNSAKHFKDANIPALCDQCAYRSIEDGGNGKCPKYEVGAVCAIREDFLKFINELDTRNPEDLKAMIDMIAKISFENVLMALTQAKMDGNIPDRNTKSEIKTLLEIVKSINDLNSKIVVTEKQEYDKEGDIANIFRQIKAQKGGGD*
Ga0066836_101960695F065107N/AVKKLARPTNEEIEERKDFMQVIAECATNPSKFSEVFLNHKLFDYNQKYVNCKDRFIVYRSGRQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.