Scaffold Ga0079045_1015186

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079045_1015186

Scaffold Ga0079045_1015186

Overview

Basic Information
Taxon OID	3300006180 Open in IMG/M
Scaffold ID	Ga0079045_1015186 Open in IMG/M
Source Dataset Name	Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_virus_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	593
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa → Sporomusa ovata	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park
Coordinates	Lat. (^o)	44.7315	Long. (^o)	-110.7113	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026606	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079045_10151861	F026606	N/A	MVENEYEKIEQKLKEFLGIESGELREKIIEKAVWLDKDYSRMVVLRIYPGGTYDIGIGQEGNYDGLSNEERLWVEFSLIEPWDLPEFERVVEDENGDWVDQDNGDKFEGDELFDVVFSSVVSGFYDKFEYEWKKFLKEFDKWYEMLKNLGYKGE*LKMEIEDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.