NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075427_10000113

Scaffold Ga0075427_10000113


Overview

Basic Information
Taxon OID3300006194 Open in IMG/M
Scaffold IDGa0075427_10000113 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7046
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (73.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium aegyptiacum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8443Long. (o)-83.9607Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002758Metagenome / Metatranscriptome532Y
F010485Metagenome / Metatranscriptome303N

Sequences

Protein IDFamilyRBSSequence
Ga0075427_1000011313F010485GGAGMIRSFTVVALMCMTSGETATAFDLNKTLKDLMPCKYAAIRLCERPQQVSAAALWKCGATLAAAPQDEIGKRCVAVLKRYGAALN*
Ga0075427_100001139F002758AGGAGGMKVAALAALSVLIALPAQAGERHRQNNVSLICDNDGRCTTLSVTAPTTLRGRHTGTSERKPLRVIDANGNRMLATVQTVYGFNITVHPAYASKFLKFFALLKERGYKVPANITRCWAPRGTHVAGSNHYIGAACDIQTGWNRGPAFVYHMDDIIKQAGLYSGCTFRDCGHVEAVRGLHNRPPNLYAAMEKFRSEQSTANYQP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.