Scaffold Ga0099364_10230685

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099364_10230685

Scaffold Ga0099364_10230685

Overview

Basic Information
Taxon OID	3300006226 Open in IMG/M
Scaffold ID	Ga0099364_10230685 Open in IMG/M
Source Dataset Name	Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2047
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Pointe-Noire, Republic of the Congo
Coordinates	Lat. (^o)	-4.7	Long. (^o)	11.83	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026114	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099364_102306853	F026114	GGTGG	MDFVEGETGSCSETCVMFEEVSIKVEEAIDIKTEIPEAESFPPINTEHEVRLQGVCEAVAAHAFRPFIAQTRKL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.