NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099372_1000449

Scaffold Ga0099372_1000449


Overview

Basic Information
Taxon OID3300006253 Open in IMG/M
Scaffold IDGa0099372_1000449 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 159510762
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42670
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (96.49%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018385Metagenome235Y
F043991Metagenome155N

Sequences

Protein IDFamilyRBSSequence
Ga0099372_100044911F043991AGGAGMGKNKPSAVDGFDLNGNVIEEANEFDGVLIEEWVNQRSPLKPSWVGRYSDQMHFDLKDGTEVSFYKRPDIVYGDILFAEGIRTILFKCRQKKNLTRFISRVLKLAEMGPSSVHPDLRA*
Ga0099372_100044916F018385GGAGMAEYVNRWDPYSELSIEKDRDPVLDDHLIYGTNVEHYTLTVYSPEGRVSKYWNARILKDDLGRCRIACPREGKILCFSWFDWDAHMFTHDGMNELVFAPKLNSRSPQSLWSKKEVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.