NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099623_1000018

Scaffold Ga0099623_1000018


Overview

Basic Information
Taxon OID3300006322 Open in IMG/M
Scaffold IDGa0099623_1000018 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 159551223
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)120137
Total Scaffold Genes136 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)66 (48.53%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051211Metagenome144N
F095630Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0099623_100001858F095630GAGMYSSLYKISKDNGLLAHVYEHLLAQYVLKYLQDRGFFISSDIILTAKTYGDTCYMDAELHNPAAPNVYNEALRAFDKHAIPEKAVRRAVSECGIEMNRAVLELKQDELMSNLSRMQSSDWRQQSEMTYRKSYDKSSVDTLFCVPYLKYGKKSNKLFPECVLEYSVDEEHIKSPIDQALTAIVVQTVALNFLVAVRENHIVYDRGDQWSEASLSVGYRIFLGLAKEDKQITSQLKHEFTAYIQYLLKSPFCSNLQKALIRCSCNLEQVLLGRSTLNNILGGCVIGGCGWLEMADDARIKQMIAAIQLDVYDI*
Ga0099623_100001888F051211N/AMRVKKAIRIFEKIRDLPYGTSGSDEVWSCYQKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHTLNLRRQRHERHVILRVFIDGSTYNIDPSIDIGLAPTLPIAHWDSTSNTATMVSLKHLRIYRPHSLHERILSRLRRNLFRDNPKEFYTEIDKWLADTRAHQSP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.