NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068488_1360139

Scaffold Ga0068488_1360139


Overview

Basic Information
Taxon OID3300006331 Open in IMG/M
Scaffold IDGa0068488_1360139 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2035
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002745Metagenome533Y
F060128Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0068488_13601391F060128AGGMADEFDFGFSAVSTEEFSKTQTVTETQPSAVSSEEFGELKKKLDSISSLIQTLGDREDTSLYDETGEIVAAN
Ga0068488_13601393F002745N/AMKSFKQYIREFAQQSTSDYVFNAGSDSSSLKIPISGPMFKRIWPDTIRTTVFHTTDPWGLESLAKLEGGKKTISAFFSMMSRYMVTGVSTSGDVHVVVEMDADVLISARDDIWSIVDKTGRRWVEMSWFANAYLGGTGPKFDKVEKDLNTLIKNLVKKHLTPILGRSKVQREHEYELWSNMKSHLKAGREGGGNRLRLVIKDYFDGVEKVIKKNKEVMGNILYGYAKSKRMTDNAWDEQIVNNIKVKTIHIWPDKPGIWSQTEDEIKQQITNIKKWSIKSWDASIELEAYTREVVKKEIGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.