NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068500_1006707

Scaffold Ga0068500_1006707


Overview

Basic Information
Taxon OID3300006332 Open in IMG/M
Scaffold IDGa0068500_1006707 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1781
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000681Metagenome / Metatranscriptome939Y
F012681Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0068500_10067073F000681AGGAGMYKRDDHYYSVISTEDLYKELNTNYTGETDLVQSLMSQAISEGLVATRHELGVANEELWSLNDWPEGEGFGTSDFYSYRKRIAETIARERKFLQAENELVQINKLTESPKNDTVHQYMKINEKLKEGLVA*
Ga0068500_10067075F012681N/ADSDPENANKEIPKRAQFDQPFYEYNNICHMNGPEWADSQTMYIEELDKNGQSLEDDDGGYIQDIQHDFGDLESLGAEVVCDEEHHASSKSCENEYYVFGQYFNKGGWHTPDIIKTGPDGIEIDKLKIRYSNADGFQVFNEIEYDGEVYYLEEDSTGKSSSFYVNRGEKLDG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.