 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006338 Open in IMG/M |
| Scaffold ID | Ga0068482_1505904 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 761 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 770 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007773 | Metagenome | 345 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068482_15059042 | F007773 | GAG | VNQNNVINLSDYREEKEKETPQNPSQYIQDFEVGGYYIYPELGVMLHCMLITDSSHTHNNELMYIMEDQFGDLLSVPISDPDSMMGWRFLDKQVFIEIVKKNLSKPEFEPEPPRVS* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |