Scaffold Ga0099696_1105152

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099696_1105152

Scaffold Ga0099696_1105152

Overview

Basic Information
Taxon OID	3300006346 Open in IMG/M
Scaffold ID	Ga0099696_1105152 Open in IMG/M
Source Dataset Name	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2094
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)	770
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009177	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099696_11051521	F009177	N/A	PLHAVLDLGNTAIANNSGTTLSGAYGLVIDHDDTIATRTGQPTAFISFGEMYVGGTESIETKYLFDIFPNGKTGDATYATAADVAFYNDGAQYATTRDTMILNSSDGAPASDAGDHVMMEQDPYDSIQMEDNYMIETEDGEAILLEVQDNVGTATPILFETGSQDADGVLKIRVNGEDKYIQLYNVVS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.