Scaffold Ga0068871_100228706

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068871_100228706

Scaffold Ga0068871_100228706

Overview

Basic Information
Taxon OID	3300006358 Open in IMG/M
Scaffold ID	Ga0068871_100228706 Open in IMG/M
Source Dataset Name	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1614
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location Name	USA: South Gull Lake, Michigan
Coordinates	Lat. (^o)	42.405765	Long. (^o)	-85.399014	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049877	Metagenome / Metatranscriptome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068871_1002287063	F049877	GAG	VQLRLFVLVLAPVGDARASQIVDNSPMTIEMLGRMRGEVDPDDMGRLARCCTHARLPQTPAAAGYRYYDLGGAAPSFYLRRFRLGTRTAAVSLIAPVELSSGLDAERGAPALAQVVLSVGARPIPWHEVCEPDLFPGDSALLARAALQAVLELDLLTDDECP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.