Scaffold Ga0079066_1540442

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079066_1540442

Scaffold Ga0079066_1540442

Overview

Basic Information
Taxon OID	3300006395 Open in IMG/M
Scaffold ID	Ga0079066_1540442 Open in IMG/M
Source Dataset Name	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	782
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified ssDNA viruses → Circovirus-like genome RW-C	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	Urbana, Illinois, USA
Coordinates	Lat. (^o)	40.1191	Long. (^o)	-88.1952	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017318	Metagenome / Metatranscriptome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079066_15404421	F017318	N/A	AFDITTTGLVSNFGVFNFSLNDLPNYTEFTTLFDLYKIEAIEIEWIPEYTELTDAALVSNAVNVYFNSAIDPAGNTPASVDDVLQYRTLHSTSITKHHKRRFVPAYLADGILPVSSYISCASPSTNMYGLVYGVPVTGVAMTFRSRARYYLSMAQAR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.