Basic Information | |
---|---|
Taxon OID | 3300006421 Open in IMG/M |
Scaffold ID | Ga0082247_10013802 Open in IMG/M |
Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1090 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → environmental samples → uncultured Woeseiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fram Strait | |||||||
Coordinates | Lat. (o) | 78.153207 | Long. (o) | 5.975413 | Alt. (m) | Depth (m) | 1200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103292 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082247_100138022 | F103292 | AGG | MILRWRFETQLPYGRFVAVVSEDGDGFSAEIEGETVANPRIGGPRTRNRIITDQHYGPESVHAHSLEALRHAVEENIENHIGPVNKWTADPG* |
⦗Top⦘ |