Scaffold Ga0075037_1540614

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075037_1540614

Scaffold Ga0075037_1540614

Overview

Basic Information
Taxon OID	3300006426 Open in IMG/M
Scaffold ID	Ga0075037_1540614 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	520
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	68.6137	Long. (^o)	-149.3144	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014564	Metagenome / Metatranscriptome	262	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075037_15406141	F014564	N/A	AGVPMTDAVIKETAIQEANHAFSKQVTNQVARITGELNRLEQLLSAGMVDRRVLSEFRYAVDRARKTGWQVEKWLAGDSRELSTMITEERIHCIARLVNHLAPELEAEGKNFAGVNSLREAMQKLSVVLAKTP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.