NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070744_10124778

Scaffold Ga0070744_10124778


Overview

Basic Information
Taxon OID3300006484 Open in IMG/M
Scaffold IDGa0070744_10124778 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary, USA - metaG S.535
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)741
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F013891Metagenome / Metatranscriptome267Y
F073544Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0070744_101247781F013891N/ARIREIKKPDTSLQMDIARYPDFLAIRLYEDNFLKYEGMKKEMVIDYVGKVKKLIESYGVRCVLEGVPSARILRSN*
Ga0070744_101247782F073544AGGVREYYEVIKIVFIHAERIYGSVESLGIYASKVKYQKDGIEIEEVLENDEFTIMDEIVFEHVEESN*
Ga0070744_101247783F000671GAGGMEKILCYSCNKTKNKLNVRKSILIPINLLMCETCITSKFEPRWVIILAGRQLGSDSVKEFIIKKRYCGNDIAASELLV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.