 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006561 Open in IMG/M |
| Scaffold ID | Ga0101389_1001263 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Black Sea in Odessa region - Od_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1001 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Vapnyarka, Odessa Oblast, Ukraine | |||||||
| Coordinates | Lat. (o) | 46.35116 | Long. (o) | 30.5519 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039123 | Metagenome | 164 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101389_10012633 | F039123 | N/A | GQLTEELDHFPLPKVIRSKLNKLSSSKTEGGGEKTNSTSESEEIATRLLEHRHGVQYDGVTVKRPENVPAWIEQLVDRVDNDLGVQYPLKAKLGTLGFMVVQTEGRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |