NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101389_1003985

Scaffold Ga0101389_1003985


Overview

Basic Information
Taxon OID3300006561 Open in IMG/M
Scaffold IDGa0101389_1003985 Open in IMG/M
Source Dataset NameMarine microbial communities from the Black Sea in Odessa region - Od_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHellenic Centre for Marine Research (HCMR)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)686
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome

Source Dataset Sampling Location
Location NameVapnyarka, Odessa Oblast, Ukraine
CoordinatesLat. (o)46.35116Long. (o)30.5519Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043435Metagenome / Metatranscriptome156Y
F077491Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0101389_10039851F077491N/AMKVLGTKYGIEITKPWNKEMYDHNDKVADLMKAELKLALVKAYKNKDEELLRGVASVIEPSGYGYGFDMEGIYKDALNGLEMVQNYWLNEEYPYGVEKGIVPSVELEFIGY*
Ga0101389_10039852F043435N/AMKNQKTLEALRKKAGLGICENSRMPNLNKVGQLLTELGIENDVTTWSCTKWTSAAGCRYNTSGGTRDYNGFRLKVPQINMNINSTDTYYSWNTEMFAQQLVKLIDTL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.