NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074054_11329484

Scaffold Ga0074054_11329484


Overview

Basic Information
Taxon OID3300006579 Open in IMG/M
Scaffold IDGa0074054_11329484 Open in IMG/M
Source Dataset NameSoil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)968
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location
Location NameLaval, Canada
CoordinatesLat. (o)45.54Long. (o)-73.72Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021801Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0074054_113294842F021801GGGGGMLIAAVLLSVAGCSLIGRAAVPSEPFGDFVVGEFGGIDGRQNILYVRTDGVALLVSRAPAAGKLSDRTMSRLQTLLTSGQFRQEVARYAKRKQRAPMPVCADQVTTEVTMRSLSMSRSDPCQEESEPSPAFDEIVSLVAPALRGNFDGPVDSGEPRLFPLRLERIQAHDQPAYTITVDAAGRAMITLSGRRSELHALSVPERDTLRLLLARVIEKPIAPCTAPAYYRLHVDKEVPVDGPDCGFPDRQPEFRALAAMLEHDFGV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.