 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006627 Open in IMG/M |
| Scaffold ID | Ga0101571_11510218 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from the Leymus chinensis steppe, China - after adding 28 g N m- 2, yr-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chengdu Institute of Biology, Chinese Academy of Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 540 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | the Inner Mongolia Grassland Ecosystem Research Station (IMGERS), China | |||||||
| Coordinates | Lat. (o) | 43.63 | Long. (o) | 116.7 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016524 | Metagenome / Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101571_115102181 | F016524 | N/A | PIRVEGWAYTPGARVSLRLQFRSQSTYARVKAQFHNPSGGVIKLEGVTHTREESGAAHTEVVLTGNVPENAALGTYECRSVEGLTGEGKWAPIFEDPAFNIRVVQRPFHAQRGGEFLGLEPA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |