Scaffold Ga0075525_10005958

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075525_10005958

Scaffold Ga0075525_10005958

Overview

Basic Information
Taxon OID	3300006636 Open in IMG/M
Scaffold ID	Ga0075525_10005958 Open in IMG/M
Source Dataset Name	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2840
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	USA: Barrow Environmental Observatory site, Alaska
Coordinates	Lat. (^o)	71.299	Long. (^o)	-156.61	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018648	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075525_100059584	F018648	AGGA	MSAIMQETTAPSIIVTTGEALPEFSEEYSKGELEEMGSRELLAGYAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.