NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075471_10015702

Scaffold Ga0075471_10015702


Overview

Basic Information
Taxon OID3300006641 Open in IMG/M
Scaffold IDGa0075471_10015702 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4555
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005845Metagenome / Metatranscriptome388Y
F006503Metagenome / Metatranscriptome371N
F087100Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0075471_1001570215F087100GGTGGMECKHCGFEYERKPKPPGEVVSLQMLTKAQGMEMAKQSTMYQKAQLAKAKVISPFWVLHNCKTRAEAEEFVSYMGWRRGWLYHNAKRFKIFQS*
Ga0075471_100157024F006503GGAMTNDQFIVAQKHRKYWDQYVASLTMRLPPDAVGELQAILTAHGQPPTNWWCADCVKSALQYIYLQADLFLEVNQNTVTIPLSNAPANPEQ*
Ga0075471_100157028F005845N/AMKTTPTDFRRWQIHIRKECVNCNRPDKSETIKAWSVNWTLLGRILQAKNA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.